Protein Info for DZA65_RS17155 in Dickeya dianthicola ME23

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 81% identical to PANB_PECAS: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 98% identity to dze:Dd1591_1028)

MetaCyc: 76% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
superpathway of coenzyme A biosynthesis II (plants) (5/10 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C9N6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>DZA65_RS17155 3-methyl-2-oxobutanoate hydroxymethyltransferase (Dickeya dianthicola ME23)
MKATTISHLRQWKQEQKKFATLTAYDASFAQLFYEQGIRVMLVGDSLGMPVQGHDSTLPV
TIDDMVYHTRCVRRGAAHCLLLSDLPFMGAATPEQACQQAAALMRAGANMVKIEGGSWLV
PTVRMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRDEAAASQLLEDALALEQAGAQLLVL
ECVPVLLAQRVTEALSIPIIGIGAGNVTDGQILVMHDALGVTGGHTPKFARNFMAEAADI
RAAVRLYVQEVEQGTFPDEQYSFV