Protein Info for DZA65_RS17125 in Dickeya dianthicola ME23

Annotation: RNA 2',3'-cyclic phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02258: 2'-5' RNA ligase" amino acids 6 to 174 (169 residues), 126.9 bits, see alignment E=4.1e-41 PF02834: LigT_PEase" amino acids 12 to 89 (78 residues), 47.2 bits, see alignment E=2.1e-16 amino acids 93 to 131 (39 residues), 23.9 bits, see alignment 4e-09 PF13563: 2_5_RNA_ligase2" amino acids 14 to 136 (123 residues), 55.2 bits, see alignment E=8.6e-19

Best Hits

Swiss-Prot: 62% identical to THPR_ECOLI: RNA 2',3'-cyclic phosphodiesterase (thpR) from Escherichia coli (strain K12)

KEGG orthology group: K01975, 2'-5' RNA ligase [EC: 6.5.1.-] (inferred from 97% identity to ddd:Dda3937_00508)

MetaCyc: 62% identical to RNA 2',3'-cyclic phosphodiesterase (Escherichia coli K-12 substr. MG1655)
6.5.1.-; RXN-15952 [EC: 3.1.4.58]

Predicted SEED Role

"2'-5' RNA ligase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.58 or 6.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0Q5 at UniProt or InterPro

Protein Sequence (177 amino acids)

>DZA65_RS17125 RNA 2',3'-cyclic phosphodiesterase (Dickeya dianthicola ME23)
MTPTRRLFFALSLPDAIGQQIVHWRAAQFAPEAGRPVAAANLHLTLAFLGEVSDAKMQVL
QTLAGRIRQPAFTFNLNDAGHWPRPGVVWLGCRQAPRGLLQLADMLRSQAARNGCYQPPQ
PFHPHITLLRGATRPVPVPAATFGWTVQAEQFFLYESRAEAGRTHYQPVAHWPLPTR