Protein Info for DZA65_RS16950 in Dickeya dianthicola ME23

Annotation: autonomous glycyl radical cofactor GrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04365: autonomous glycyl radical cofactor GrcA
  • amino acids 2 to 127 (126 residues), 242.3 bits, E=5.4e-77
• PF01228: Gly_radical
  • amino acids 12 to 108 (97 residues), 75.4 bits, E=2.4e-25

Best Hits

Swiss-Prot: 91% identical to GRCA_PECCP: Autonomous glycyl radical cofactor (grcA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06866, autonomous glycyl radical cofactor (inferred from 96% identity to dze:Dd1591_1058)

MetaCyc: 81% identical to stress-induced alternate pyruvate formate-lyase subunit (Escherichia coli K-12 substr. MG1655)
Formate C-acetyltransferase. [EC: 2.3.1.54]; 2.3.1.54 [EC: 2.3.1.54]

Predicted SEED Role

"Pyruvate formate-lyase (EC 2.3.1.54)" in subsystem Butanol Biosynthesis or Fermentations: Mixed acid (EC 2.3.1.54)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (15/16 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• L-threonine degradation I (6/6 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.54

Use Curated BLAST to search for 2.3.1.54

Sequence Analysis Tools

See A0A3A4DPI0 at UniProt or InterPro

Protein Sequence (127 amino acids)

>DZA65_RS16950 autonomous glycyl radical cofactor GrcA (Dickeya dianthicola ME23)
MVTGIQITKANNNALINSFWLLDEEKSQARCVCAKSDFNEDQIVAISDLGQFEYREVPLE
IKAEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIT
RTFTESL