Protein Info for DZA65_RS16865 in Dickeya dianthicola ME23

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 44 to 156 (113 residues), 64.7 bits, see alignment E=9.1e-22 PF00989: PAS" amino acids 47 to 147 (101 residues), 43.4 bits, see alignment E=9.2e-15 PF13426: PAS_9" amino acids 48 to 151 (104 residues), 57.9 bits, see alignment E=3.4e-19 PF08447: PAS_3" amino acids 60 to 144 (85 residues), 39.2 bits, see alignment E=2.2e-13 PF13185: GAF_2" amino acids 174 to 318 (145 residues), 58.5 bits, see alignment E=2.6e-19 PF01590: GAF" amino acids 215 to 317 (103 residues), 37.9 bits, see alignment E=7.6e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 335 to 496 (162 residues), 137.2 bits, see alignment E=4.3e-44 PF00990: GGDEF" amino acids 337 to 493 (157 residues), 155.9 bits, see alignment E=2.3e-49

Best Hits

KEGG orthology group: None (inferred from 99% identity to ddd:Dda3937_03858)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1S1 at UniProt or InterPro

Protein Sequence (505 amino acids)

>DZA65_RS16865 sensor domain-containing diguanylate cyclase (Dickeya dianthicola ME23)
MYEIIITLLIVLLGISSARSRKFQEKANAEQKKQDFLNMVFFAAEYSPSSIMIANESCEI
VYVNRQFTVMSGYEAEEVIGRKTNILSSGMTNASVYEELWSTLNKGEIWNGEFINRKKNG
QLYWEKASIVKIYNKASDAVQYVSIKMDITERKTQEHHDNSYNRALELLSSGAPLKDILD
AIIFSVEEKNPGRIVCSVLLVDKEKKCLTLGSAPSLPGFYKNAIHNVKIADGAASFGSAA
YSGKRVIAEDISTHPHWTLYKGLALYAGLRSCWSEPIFGQNKEILGVLSVYHRKVYSPTE
DEIASIEKSAQLVAVAIERYRAIDMLRRSEEHYRQLAHYDSLTSLANGLTFAEQMEQAIQ
LSRQTHRKIALMFLDLDKFKQINDTFGHATGDLLLKEAAARMRGAVRETDTVYRRSGDEF
IILLQGIKEVENTLYVADKIHHALNEPFYIEGKKLDISCSIGIALYPEHGTDSLTLAINA
DAAMYQAKALGRSQTQIYHDLNTHQ