Protein Info for DZA65_RS16765 in Dickeya dianthicola ME23

Annotation: DUF1007 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF06226: DUF1007" amino acids 17 to 219 (203 residues), 232.9 bits, see alignment E=2e-73

Best Hits

Swiss-Prot: 39% identical to Y1249_HAEIN: Uncharacterized protein HI_1249 (HI_1249) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_02382)

Predicted SEED Role

"FIG00923183: possible membrane protein YebY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1Q2 at UniProt or InterPro

Protein Sequence (220 amino acids)

>DZA65_RS16765 DUF1007 family protein (Dickeya dianthicola ME23)
MLHYSNFGFSFRWVRCLLLTVAAVSGPALAHPHSFIDMKTTVEGKDEQVTGLRMNWTMDP
ITSADLLYDAGNAAKDSEVWKKLAAEVMANVLGQHYFTDVYRDGKPVKYQPLPTEYHLSR
AGNKAVLEFVLPLAHPQPLAGAPLLISTYDPTYFVDMSYKDDKAIQVASALASRCKTTLM
TPKPDASLQSYALALDKNAKPSKDVELGKQFAQQVTLQCR