Protein Info for DZA65_RS16745 in Dickeya dianthicola ME23

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details PF01032: FecCD" amino acids 41 to 355 (315 residues), 279.7 bits, see alignment E=2.8e-87 PF00950: ABC-3" amino acids 88 to 328 (241 residues), 21.1 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 98% identity to ddd:Dda3937_02378)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4S8 at UniProt or InterPro

Protein Sequence (360 amino acids)

>DZA65_RS16745 iron ABC transporter permease (Dickeya dianthicola ME23)
MSVTTESPISRVSAAENSAIIHYRHIIRHRLAVMAVLVVAIVASLLLDFVLGPSGLPLDV
LWQTLTDPANADAGSRVIVWDIRLPYALMAVVVGLALGLAGAEMQTILNNPLASPFTLGV
SSAAAFGAALAIVLGVGIPGIPAQWFISANAFLFALLAALLLDGITRWTKVATSGVVLFG
IALVFTFNALVSILQFIANEDTLQGLVFWTMGSLARSSWEKLGILLLVLAVVMPLSMLSS
WKLTALRLGEDRAISFGINVRRLRLTTLLRISFLSALSVAFVGPIGFIGLVAPHIARIIF
GEDHRFYLPASALTGALVLSLASVVSKNLLPGVIIPVGIVTSLVGVPFFLSIILRNRGNV