Protein Info for DZA65_RS16280 in Dickeya dianthicola ME23

Annotation: general secretion pathway protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 366 to 391 (26 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 42 (42 residues), 27.9 bits, see alignment 1.6e-10 PF00482: T2SSF" amino acids 69 to 191 (123 residues), 102.2 bits, see alignment E=2e-33 amino acids 272 to 393 (122 residues), 64.7 bits, see alignment E=8.5e-22

Best Hits

Swiss-Prot: 46% identical to GSPF_PECCC: Type II secretion system protein F (outF) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: None (inferred from 91% identity to dze:Dd1591_3313)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4N4 at UniProt or InterPro

Protein Sequence (401 amino acids)

>DZA65_RS16280 general secretion pathway protein F (Dickeya dianthicola ME23)
MRNFRYIAVNTEGELVTGRHRAFSKESLREQLFARQLIMVSCRVSLLQQWLLLLSRHERL
STLDLALLTRQLASLLEAGIPLEEALTTLASQADKHAVGAVLNAVREQLIAGLSFAQALQ
TLPYNFNRLYCAMVAAGEATGCLALVLIRLADYLDQHQKTKNALIQALLYPVLLAVMSVI
VVSILLSSVVPQVVMQLQQTHTPLPLTTRTLLAISDVLNHYGWMLPVALAALAVGLHQIV
RIPARKLWLDRHLLRLYAVGPLLRDISSARYIRTMEILIASAIPLLESMSVAENVLNNSF
ARFQLTVASQKVNEGKSLTESLSNNDIFSGMVKHMIASGERSGRLEPMLKYIADIQEESL
KRRISLLLLLGENGLLIIISSLVLFIVMSILQPIMQLSNTI