Protein Info for DZA65_RS16255 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 111 (96 residues), 83.9 bits, see alignment E=4.7e-28 PF00528: BPD_transp_1" amino acids 40 to 218 (179 residues), 62 bits, see alignment E=3.3e-21

Best Hits

Swiss-Prot: 30% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 90% identity to dze:Dd1591_1186)

Predicted SEED Role

"putative amino acid ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2C7 at UniProt or InterPro

Protein Sequence (222 amino acids)

>DZA65_RS16255 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MFDGWVNFYNDLIDQLPLVLDGVVETLKLAAIVSLSGLLWGIVIFFLSVSNQPAVKNITK
IYMDFFIGTPLILILFVIYYGLPQTGIHLSPFVVAVTGFTLNVGAYNAAYMTTAYNALNK
QETEAAIVQGFSRWQIFRLIILPQVFITSIPALTNQVINNIKDSTIAFLIQYTEFFSRIQ
EVASTNFEFFNAYLFAALVYLVFITFIVMLSRFIERKLGIAE