Protein Info for DZA65_RS16225 in Dickeya dianthicola ME23

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00356: LacI" amino acids 2 to 47 (46 residues), 68.1 bits, see alignment 9.4e-23 PF00532: Peripla_BP_1" amino acids 59 to 312 (254 residues), 98.6 bits, see alignment E=9.1e-32 PF13407: Peripla_BP_4" amino acids 63 to 305 (243 residues), 68.5 bits, see alignment E=1.4e-22 PF13377: Peripla_BP_3" amino acids 167 to 325 (159 residues), 109.2 bits, see alignment E=4.7e-35

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_02809)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CAB6 at UniProt or InterPro

Protein Sequence (326 amino acids)

>DZA65_RS16225 LacI family transcriptional regulator (Dickeya dianthicola ME23)
MSIQKIARLAGVSVATVSRVLNNQDSVKPQNRERVLNAIQQSNYQPNLLARQLRTAKSHM
LLVMVSNIANPFCADVVKGIESEAERNGYRILLCNSGSDTARAKSSLSLLSGKMVDGVIT
MDALSRLPELTTIIGDAPWVQCAEYADAAAVSSVGIDDRLASRFVLEHLLKNNRQRIAMI
NHDLNYKYAQLREQGYREMIAEHALHYDSVIYASELSYQAGKKAMLALLDEEIRPDAVFA
VSDTLAAGALKAIEDTGLQVAKDIAVIGFDGTELSYITSPQLSTVQQPSQEIGRQAVKLL
LQKINDPDSLPEKRILDWQFISRASG