Protein Info for DZA65_RS16155 in Dickeya dianthicola ME23

Annotation: NupC/NupG family nucleoside CNT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 62 (29 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 241 to 292 (52 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF01773: Nucleos_tra2_N" amino acids 10 to 81 (72 residues), 58.7 bits, see alignment E=1e-19 PF07670: Gate" amino acids 90 to 190 (101 residues), 60 bits, see alignment E=4.3e-20 PF07662: Nucleos_tra2_C" amino acids 192 to 390 (199 residues), 203.7 bits, see alignment E=4.3e-64

Best Hits

Swiss-Prot: 77% identical to NUPC_ECOL6: Nucleoside permease NupC (nupC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11535, nucleoside transport protein (inferred from 99% identity to ddd:Dda3937_02822)

MetaCyc: 77% identical to nucleoside:H+ symporter NupC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-108A; TRANS-RXN-108B; TRANS-RXN-108C; TRANS-RXN-108D; TRANS-RXN-108E; TRANS-RXN-108F; TRANS-RXN-108G; TRANS-RXN-108H; TRANS-RXN-108I; TRANS-RXN-476

Predicted SEED Role

"Nucleoside permease NupC" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CES4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DZA65_RS16155 NupC/NupG family nucleoside CNT transporter (Dickeya dianthicola ME23)
MSNILQFILALLVVAGLSLLVCRDRKNIRVRYIVQLLVIEILLAYFFLYSSAGLGFVTGF
ASLFDKLLSFAGEGTTFVFGNIGNNSFVFFLKVLCPIVFISALIGILQHIKVLPLIIRLI
GTILSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGQMSEKRMYTMAATAMSTVSMSI
VGAYMSMLDAKYVVAALVLNMFSTFIVLSLINPYDTNEEKELHLSNLHEGQSFFEMLGEY
ILAGFKVAVIVAAMLIGFIALIAGINALFSAVFGLSFQEVLGYVFYPLAWVMGIPKAEAL
QVGSIMATKLVSNEFVAMMELQKVAGQLSPRSVGILSVFLVSFANFSSIGIVAGAIKGLN
EMQGNTVSRFGLKLVYGSTLVSLLSAAVAGLVL