Protein Info for DZA65_RS15965 in Dickeya dianthicola ME23

Annotation: ribosome-associated protein YbcJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 70 PF13275: S4_2" amino acids 8 to 68 (61 residues), 79.4 bits, see alignment E=7.4e-27

Best Hits

Swiss-Prot: 73% identical to YBCJ_ECOLI: Uncharacterized protein YbcJ (ybcJ) from Escherichia coli (strain K12)

KEGG orthology group: K14761, ribosome-associated protein (inferred from 91% identity to dze:Dd1591_1249)

Predicted SEED Role

"FIG002958: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C864 at UniProt or InterPro

Protein Sequence (70 amino acids)

>DZA65_RS15965 ribosome-associated protein YbcJ (Dickeya dianthicola ME23)
MNVFHLDKHPHVELCDLLKLQGWSESGAGAKLAIAAGEVTVDGQTETRKRCKIVAGQVVC
FGSESVTVQA