Protein Info for DZA65_RS15735 in Dickeya dianthicola ME23

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF08007: JmjC_2" amino acids 95 to 210 (116 residues), 132.8 bits, see alignment E=5.2e-43 PF20514: WHD_ROXA" amino acids 257 to 369 (113 residues), 101.5 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 68% identical to ROXA_ECOLI: 50S ribosomal protein L16 3-hydroxylase (roxA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_02402)

MetaCyc: 68% identical to 50S ribosomal protein L16-arginine 3-hydroxylase (Escherichia coli K-12 substr. MG1655)
RXN0-7090 [EC: 1.14.11.47]

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3I9 at UniProt or InterPro

Protein Sequence (373 amino acids)

>DZA65_RS15735 cupin domain-containing protein (Dickeya dianthicola ME23)
MAYQLNLNWPEFLEKYWQKQPVVLKNAFPNFVDPITPDELAGLAMEPEVDSRIVSHVNGQ
WQAWNGPFEQFDHLGETDWSLLAQAVNHWHAPSAELVRPFRVLPDWRLDDLMISFSVPGG
GVGPHIDQYDVFIIQGMGRRRWRVGAKLPMRQFCPHPALLHVDPFTPIIDEELEPGDILY
IPPGFPHDGFTFETAFNYSVGFRGPNGRDLISSFADYALENDLGGEHYSDPDLTCREHPG
RVEEYELDRLRAMMIDMINQPEDFKQWFGRFVTTPRHELDIAPAEPPYQQDEIADALMAG
EVLTRLSGLRVLHVGDSVFINSERLETVAPEAADALCRYTTLGKKELGEALHNPAFIAEL
TELVNQGYWFFDD