Protein Info for DZA65_RS15700 in Dickeya dianthicola ME23

Annotation: GspS family T2SS pilot lipoprotein variant OutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01004: lipoprotein, PulS/OutS family" amino acids 1 to 132 (132 residues), 203.9 bits, see alignment E=3.2e-65 PF09691: T2SS_PulS_OutS" amino acids 18 to 127 (110 residues), 179.3 bits, see alignment E=9.6e-58

Best Hits

Swiss-Prot: 93% identical to OUTS_DICD3: Pilotin OutS (outS) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_02411)

Predicted SEED Role

"Lipoprotein outS precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJF2 at UniProt or InterPro

Protein Sequence (133 amino acids)

>DZA65_RS15700 GspS family T2SS pilot lipoprotein variant OutS (Dickeya dianthicola ME23)
MHVFSLKVVLLGVCCLSLAACQTPAPVKNTASRSTASVPANEQISQLASLVAASKYLRVQ
CERSDLPDDGTILRTAVKVAAQKGWDTSRYQSLPQLSENLYQGLLKDGTPKATQCSSFNR
AMTPFLDAMRTAR