Protein Info for DZA65_RS15475 in Dickeya dianthicola ME23

Annotation: endonuclease SmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF01713: Smr" amino acids 98 to 172 (75 residues), 80.9 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 81% identical to Y3071_PECAS: UPF0115 protein ECA3071 (ECA3071) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00491)

Predicted SEED Role

"FIG001674: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1Y6 at UniProt or InterPro

Protein Sequence (180 amino acids)

>DZA65_RS15475 endonuclease SmrB (Dickeya dianthicola ME23)
MKKKFILDDEEQALFRTSVAGATRLRQDTYVHRPARIRPGALPPRRMIQEQVDASFYFSD
EFQPQLENEGPTRYVRPGASHYELKKLRRGDYSPELFLDLHGLTQLEAKQELGALLAACR
REHIYCACVMHGHGKHILKQQTPLWLAQHPDVLAFHQAPREFGGDAALLVLVAQESADEE