Protein Info for DZA65_RS15460 in Dickeya dianthicola ME23
Annotation: penicillin-insensitive murein endopeptidase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to MEPA_PECAS: Penicillin-insensitive murein endopeptidase (mepA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 96% identity to ddd:Dda3937_00494)MetaCyc: 70% identical to peptidoglycan DD-endopeptidase/peptidoglycan LD-endopeptidase (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-
Predicted SEED Role
"Murein endopeptidase"
Isozymes
Compare fitness of predicted isozymes for: 3.4.24.-
Use Curated BLAST to search for 3.4.24.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XZV1 at UniProt or InterPro
Protein Sequence (276 amino acids)
>DZA65_RS15460 penicillin-insensitive murein endopeptidase (Dickeya dianthicola ME23) MKINWIGMVALLLSSAALAKTPWQEITHPVAGQPQAIGAFANGCIIGAQPLSLQSPDYQV MRVDQRRYFGHPDLLAFINRLSADVHRTTGATVLIGDMGMPAGGRFSSGHASHQSGLDVD IWLQLPSQRWSQQQLLQPQPLDLVLADGKNINPRAWSPDVQKLVKTAAQDNDVTRIFVNP AIKKQLCLEAGSDRNWLYKVRPWFAHRAHMHVRLRCPASSLECQEQDAPPAGDGCGAELN SWFQPRKPGTEPPAKTTPPPLPPSCQALLDRHLIAE