Protein Info for DZA65_RS15460 in Dickeya dianthicola ME23

Annotation: penicillin-insensitive murein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF03411: Peptidase_M74" amino acids 36 to 270 (235 residues), 312 bits, see alignment E=1.5e-97

Best Hits

Swiss-Prot: 79% identical to MEPA_PECAS: Penicillin-insensitive murein endopeptidase (mepA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 96% identity to ddd:Dda3937_00494)

MetaCyc: 70% identical to peptidoglycan DD-endopeptidase/peptidoglycan LD-endopeptidase (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-

Predicted SEED Role

"Murein endopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZV1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DZA65_RS15460 penicillin-insensitive murein endopeptidase (Dickeya dianthicola ME23)
MKINWIGMVALLLSSAALAKTPWQEITHPVAGQPQAIGAFANGCIIGAQPLSLQSPDYQV
MRVDQRRYFGHPDLLAFINRLSADVHRTTGATVLIGDMGMPAGGRFSSGHASHQSGLDVD
IWLQLPSQRWSQQQLLQPQPLDLVLADGKNINPRAWSPDVQKLVKTAAQDNDVTRIFVNP
AIKKQLCLEAGSDRNWLYKVRPWFAHRAHMHVRLRCPASSLECQEQDAPPAGDGCGAELN
SWFQPRKPGTEPPAKTTPPPLPPSCQALLDRHLIAE