Protein Info for DZA65_RS15430 in Dickeya dianthicola ME23

Annotation: type 1 glutamine amidotransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF01965: DJ-1_PfpI" amino acids 25 to 223 (199 residues), 52.4 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to dze:Dd1591_1352)

Predicted SEED Role

"ThiJ/PfpI family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZR1 at UniProt or InterPro

Protein Sequence (225 amino acids)

>DZA65_RS15430 type 1 glutamine amidotransferase domain-containing protein (Dickeya dianthicola ME23)
MKILMVLTSHDQLGNTGKKTGFWLEEFAAPYYVFKDAGAEVVLASPAGGQPPLDPKSDLP
EFQTELTHRFKADPAAQQALATTVKLDSVSMDDFDTVFYPGGHGPLWDLAESPTSIALIE
AFERAGKPMGFVCHAPGVLRHVKAANGEPLIKGRRVTGFTNSEEAAVELTDVVPFLIEDE
FQKLGGLYSKGPDWHPYLVEDGKLITGQNPASSEVVAKALLKQLA