Protein Info for DZA65_RS15375 in Dickeya dianthicola ME23

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01118: Semialdhyde_dh" amino acids 6 to 120 (115 residues), 93.6 bits, see alignment E=1.2e-30 PF02774: Semialdhyde_dhC" amino acids 141 to 316 (176 residues), 132.8 bits, see alignment E=1.7e-42

Best Hits

Swiss-Prot: 72% identical to USG_ECOLI: USG-1 protein (usg) from Escherichia coli (strain K12)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 95% identity to ddd:Dda3937_02106)

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DNC0 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DZA65_RS15375 aspartate-semialdehyde dehydrogenase (Dickeya dianthicola ME23)
MSNGWNIALLGATGAVGTALLELLQEREFPVGELYALASENSAGESLRFSGRSLRVEDAA
DFDWSQVQLAFFVAGLEASARYADAAGNAGCLVIDSSGLFALEPDVPLVVPGVNPQVLAD
YRNRNIVAVADSLTSQLLKAIKPLTDQAGLSRLHVTNLLSVSAHGKAAVDDLAGQSARLL
NGIPPEPGLFPKQLAFNLLPLLADNEGSVREERRLVDQVRKVLQDDGLPISVGCVQSPVF
YGHAQVVHLEALRPLSADEARDVLAQAEDIALSEEDDYPTQVEDASGNVQLSIGCLRNDY
GIPELLQFWSVADNIRFGGALMAVETAERLIEEYLG