Protein Info for DZA65_RS14970 in Dickeya dianthicola ME23

Annotation: NADH-quinone oxidoreductase subunit NuoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR01958: NADH-quinone oxidoreductase, E subunit" amino acids 22 to 166 (145 residues), 175.1 bits, see alignment E=5e-56 PF01257: 2Fe-2S_thioredx" amino acids 23 to 166 (144 residues), 173.3 bits, see alignment E=1.4e-55

Best Hits

Swiss-Prot: 83% identical to NUOE_SALTY: NADH-quinone oxidoreductase subunit E (nuoE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 95% identity to ddc:Dd586_2745)

MetaCyc: 82% identical to NADH:quinone oxidoreductase subunit E (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CC80 at UniProt or InterPro

Protein Sequence (166 amino acids)

>DZA65_RS14970 NADH-quinone oxidoreductase subunit NuoE (Dickeya dianthicola ME23)
MDAPAQAASDIFVLSDTERDAIEHEKHHYEDARAASIEALKMVQKHRGWVPDGAIDAIAE
VLGIPASDVEGVATFYSQIYRQPVGRHVIRYCDSVVCHITGYQGIQAALERKLNVKPGQT
TFDGRFTLLPTCCLGNCDKGPTMMIDEDTHSQLKPEDLDSLLEQYQ