Protein Info for DZA65_RS14940 in Dickeya dianthicola ME23

Annotation: NADH-quinone oxidoreductase subunit NuoK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 54 (25 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details PF00420: Oxidored_q2" amino acids 8 to 99 (92 residues), 88.6 bits, see alignment E=9.1e-30

Best Hits

Swiss-Prot: 98% identical to NUOK_DICC1: NADH-quinone oxidoreductase subunit K (nuoK) from Dickeya chrysanthemi (strain Ech1591)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 91% identity to eoj:ECO26_3267)

MetaCyc: 91% identical to NADH:quinone oxidoreductase subunit K (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CRA6 at UniProt or InterPro

Protein Sequence (100 amino acids)

>DZA65_RS14940 NADH-quinone oxidoreductase subunit NuoK (Dickeya dianthicola ME23)
MIPLQHGLLLAAILFVLGLTGLVIRRNLLFMLICLEIMINAAALAFVVAGSYWGQSDGQV
MYILTITLAAAEASIGLALLLQLYRRRQTLNIDTVSEMRG