Protein Info for DZA65_RS14840 in Dickeya dianthicola ME23
Annotation: glutamine amidotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 94% identity to ddd:Dda3937_01827)Predicted SEED Role
"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotide salvage (13/14 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
- guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (3/4 steps found)
- L-glutamate and L-glutamine biosynthesis (5/7 steps found)
- L-citrulline biosynthesis (5/8 steps found)
- superpathway of L-citrulline metabolism (7/12 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Drug metabolism - other enzymes
- Glutamate metabolism
- Purine metabolism
Isozymes
Compare fitness of predicted isozymes for: 6.3.5.2
Use Curated BLAST to search for 6.3.5.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385Y420 at UniProt or InterPro
Protein Sequence (241 amino acids)
>DZA65_RS14840 glutamine amidotransferase (Dickeya dianthicola ME23) MTTLTANFPISSQPPSLLIVQMGEPPEPVAHAVGQQADWFGSALAAEGVRLHVVRPDAGD ALPDPGEHDAAIISGSWSMVTDRLDWSERTADWLRRSVDAGLPVLGVCYGHQLLAHALGG TVADNPNGREMGLKTVTLHDHAADDALLTAIPAQFSAYLSHLQSVVTPPPGAQVLAASEQ DGCQIIRYTPHTLSFQFHPEMDAAVMNACLRHCALPEMTDGAEPVWARRLLLDFVRLALS R