Protein Info for DZA65_RS14725 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 25 to 251 (227 residues), 127.9 bits, see alignment E=1.1e-41

Best Hits

Swiss-Prot: 49% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10013, lysine/arginine/ornithine transport system substrate-binding protein (inferred from 96% identity to ddd:Dda3937_01856)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTF9 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DZA65_RS14725 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MKKLSMLMLSLGLLSSSVALAQTELRFGLEAEYPPFESKNAKGRLEGFDIDLGNAICKAG
NFQCTWVETSFDALIPALQAKKFDAINSAMNITEKRREAIDFTPPIYRIPTQLVGKPDTG
LAPTPDALKGKNIGVLQGSIQEVYAKAHWEPKGVTVTSYKDQNLAYDDLAAGRLDGTLVM
AAAGQSGFLDKPEGKGFAFIGGPVEDTAILGSGIGFGLRKSDAALKAELDKAIKQVKDDG
TVEKLAKKYFPGFDVQVQ