Protein Info for DZA65_RS14545 in Dickeya dianthicola ME23

Annotation: TIGR03571 family LLM class oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR03571: luciferase-type oxidoreductase, BA3436 family" amino acids 19 to 323 (305 residues), 389.3 bits, see alignment E=6.2e-121 PF00296: Bac_luciferase" amino acids 46 to 244 (199 residues), 129.3 bits, see alignment E=1.1e-41

Best Hits

KEGG orthology group: None (inferred from 68% identity to bpt:Bpet1180)

Predicted SEED Role

"Coenzyme F420-dependent oxidoreductase" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHY7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>DZA65_RS14545 TIGR03571 family LLM class oxidoreductase (Dickeya dianthicola ME23)
MPPLQTQPTYPSDLASHSAYKRVFRPGSLTFGFIMPLEGYPDSPFPTLQDHQALAQFADD
AGFSALWMRDVPFYDPRFGDTGQMLDPMVYLGFLASQTTRITLGTTGMVLPLREPIILAK
QAASVDQLSGGRLLLGLSSGDRAVEYPAFGADYDNRAERYREAFGLIKTVCETSFPVAET
AYYGKLSGNLDLIPKPFKSRIPMIVVGRARQDLSWIAEESDGWIWHLSDFSTLPELLEFW
RGGYDDNRFRPYGYATFFDLDANPDAPPRRLMNGITVGRNALIKLWKEQQRQGVNHVALN
LKPLTRPAAEVMAEMAEFVLPEFPSE