Protein Info for DZA65_RS14530 in Dickeya dianthicola ME23

Annotation: alkene reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00724: Oxidored_FMN" amino acids 3 to 338 (336 residues), 287.8 bits, see alignment E=6.7e-90

Best Hits

Swiss-Prot: 44% identical to NEMA_ECOLI: N-ethylmaleimide reductase (nemA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 60% identity to yps:YPTB1206)

MetaCyc: 44% identical to N-ethylmaleimide reductase (Escherichia coli K-12 substr. MG1655)
1.3.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZ63 at UniProt or InterPro

Protein Sequence (365 amino acids)

>DZA65_RS14530 alkene reductase (Dickeya dianthicola ME23)
MRKLFNTYSMNGINLSNRVVMAPMTRSRAYNLIPTDSMVTYYRQRATAGLIVSEGSPVSM
EGRGQAYTPGIYTDEQIKGWKKVTEAVHTEGGKIFIQLWHVGRSSHIAHQPDGLAPVSSV
SCIAEGCTTHIPGDNYQSVRAFHSQPRALTTNEIPRVTQDFVQAAKNAIEAGFDGVEIHA
ANGYIFEQFINGGLNDRTDRYGGNIANRLRFTLETVDAISTAIGGHRTGIRIAPFGRLQD
MHGFDDEQDTWLALGIELTRRHLAYVHLSDQESLGAQAIPAGFLAKFREIYEGTLIVAGS
YTQERAELALREGFADLIAFGRPFIANPDLVKRMKNGWPIAVPDKDTFYTGRDAGYIDYP
TYHVD