Protein Info for DZA65_RS14480 in Dickeya dianthicola ME23

Annotation: DUF2971 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 170 to 186 (17 residues), see Phobius details PF11185: DUF2971" amino acids 169 to 254 (86 residues), 31.3 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to esc:Entcl_3845)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0A3 at UniProt or InterPro

Protein Sequence (371 amino acids)

>DZA65_RS14480 DUF2971 domain-containing protein (Dickeya dianthicola ME23)
MYLFKYYRPDFFFDKAIRYNELYFSARAQLNDPNDLNIDYRFDSNLKLWDFLLRSPCEYS
YKDLTHILDFSDLKIHKVLNKLFKGKRIKGDLESLDALFDAHTNEILGILSECLLPLKEI
DTVFYRNELDPKQFLAKQCEIGIKERLYKKIIPAVFSVSFSSKALERMMWAHYAAGFSGC
VMIYSAQEFTSPIKNIRMQLKDNLLSNNPVSFPVKPITYSNQSKEISILDPTSNIFELIL
TKNKFWKYESEYRMFVPEGNMGTGGERNIKDSVNRNAGHVFHHETSVMQGIIFGPRMSKL
KKEEIWQIIKSNMMNTNAKLFYFFDAELTQSGKINISNGQVAQKTHGYDLYKTPLTQPEL
IDAMNMLGIVR