Protein Info for DZA65_RS14110 in Dickeya dianthicola ME23

Annotation: EmmdR/YeeO family multidrug/toxin efflux MATE transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 39 to 443 (405 residues), 211.8 bits, see alignment E=7.7e-67 PF01554: MatE" amino acids 39 to 199 (161 residues), 124.9 bits, see alignment E=1.3e-40 amino acids 269 to 430 (162 residues), 69.5 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 64% identical to YEEO_ECOLI: Probable FMN/FAD exporter YeeO (yeeO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_02791)

MetaCyc: 64% identical to FMN/FAD exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-272; TRANS-RXN0-595

Predicted SEED Role

"Putative sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CS83 at UniProt or InterPro

Protein Sequence (478 amino acids)

>DZA65_RS14110 EmmdR/YeeO family multidrug/toxin efflux MATE transporter (Dickeya dianthicola ME23)
MILNTAKQLLGTLRNASWYKKRHSNRVLFWREITPLAVPIFIEGLCVVLMGIFSTFLVSW
LGKEAMAAVGLADSFNMLIIAFFTAVALGTAVVVAFSLGQRNRKQARQAARQSISLLVLI
SLLLVGLVEFAGQTIIDLIAYNAEPAVKSLALTFLRLTVWGYPALAITLVGCGALRGAGN
TRLPMIINIGMNILNILLSGVLIYGVASWQGVGFIGAGLGITLSRYLGALCVVLALTKGF
NGALRIPFHSYFAPFTTTILYEVLSIGIPASIESVMFNVGKLITQRFVAGMGTEVIAGNF
IAFSIVALINLPGNALGSTSTIIVGSRLGKGQRMQSERQLKYIFWLSNVGLCALALLSVP
TAGLMASMYTNEPDVITVVKQLIWLNALFMPIWAASWVLPAGLKGAKDASYTMWVALAGM
WGCRVIAGYILGIMLGFGVIGVWMGMFFDWIVRGALFYRRMVSGKWLWRYKPTASKGK