Protein Info for DZA65_RS14065 in Dickeya dianthicola ME23

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details PF02203: TarH" amino acids 1 to 173 (173 residues), 154.7 bits, see alignment E=3.8e-49 PF00672: HAMP" amino acids 215 to 262 (48 residues), 46.8 bits, see alignment 4.5e-16 PF00015: MCPsignal" amino acids 329 to 485 (157 residues), 203.1 bits, see alignment E=4.7e-64

Best Hits

Swiss-Prot: 68% identical to MCPS_KLEAK: Methyl-accepting chemotaxis serine transducer (tse) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: K05874, methyl-accepting chemotaxis protein I, serine sensor receptor (inferred from 96% identity to ddd:Dda3937_02779)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C7X9 at UniProt or InterPro

Protein Sequence (566 amino acids)

>DZA65_RS14065 HAMP domain-containing protein (Dickeya dianthicola ME23)
MLNRVKVVTGLVIVLGLFIALQIISGGLFFNALKSDRDIFTTTRIINQQKSELESTWSYL
LQTRNTLNRAGTRYAMDASGGVSGGVSAKELIELAKKQLVIANTHFANYEKIPYTDQQDP
AVAQVVKDNYTTLNSALSELIVFISTGRLKEFFDQPTQSFQDKFEKAYYSYKESYDKVYA
NAVEENNSAYSTALWLLISVAILVVAMALVVWLGINRSLIQPLTNLIEHIRHMAKGDLTT
RIDFHGTNEMGILADTLRHMQTEFFTTVSAVRQGAEAIYTGASEISAGNSDLSSRTEQQA
AALEETAASMEQLTSTVKQNAENARQASQLALSASETAQKGGKVVDNVVKTMHNIAGSSQ
KIADITSVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKS
LIDDSVNRVEEGSVLVESAGETMGEIVGAVTRVTDIMGEIASASEEQSRGIDQVGLAVTE
MDRVTQQNASLVEESASAANALEEQVRVLNQAVAVFRLSDGVVAGRPTAIAARMPVTKQV
LLATPASAEKEKKARTSKPTENWETF