Protein Info for DZA65_RS14045 in Dickeya dianthicola ME23

Annotation: protein phosphatase CheZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF04344: CheZ" amino acids 16 to 214 (199 residues), 262.6 bits, see alignment E=1.4e-82

Best Hits

Swiss-Prot: 79% identical to CHEZ_YERPE: Protein phosphatase CheZ (cheZ) from Yersinia pestis

KEGG orthology group: K03414, chemotaxis protein CheZ (inferred from 98% identity to ddc:Dd586_1508)

Predicted SEED Role

"Chemotaxis response - phosphatase CheZ" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C2H1 at UniProt or InterPro

Protein Sequence (214 amino acids)

>DZA65_RS14045 protein phosphatase CheZ (Dickeya dianthicola ME23)
MNPHPMPINDHASATEIISRIGQLTRMLRDSLKELGLDQAITEAAEAIPDARDRLDYVVQ
MTAQAAERALNCVEAAQPRQNQLEEESKSLKVRWDQWFENPIELSEARELVTDTRSYLES
VPDHTAFTNAQLLEIMMAQDFQDLTGQVIKRMMDVVQEIEKQLLMVLLENIPEKPSETRR
ANEGLLNGPQVDKTAAGIVSNQDQVDDLLDSLGF