Protein Info for DZA65_RS13995 in Dickeya dianthicola ME23

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 381 (381 residues), 308.5 bits, see alignment E=4.7e-96 PF00460: Flg_bb_rod" amino acids 6 to 33 (28 residues), 33.2 bits, see alignment (E = 8e-12) PF22692: LlgE_F_G_D1" amino acids 76 to 143 (68 residues), 46.1 bits, see alignment E=9.1e-16 PF07559: FlgE_D2" amino acids 165 to 280 (116 residues), 69.2 bits, see alignment E=1.1e-22 PF06429: Flg_bbr_C" amino acids 356 to 398 (43 residues), 54.2 bits, see alignment 1.7e-18

Best Hits

Swiss-Prot: 61% identical to FLGE_ECOLI: Flagellar hook protein FlgE (flgE) from Escherichia coli (strain K12)

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 94% identity to ddd:Dda3937_02206)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C2I4 at UniProt or InterPro

Protein Sequence (399 amino acids)

>DZA65_RS13995 flagellar hook protein FlgE (Dickeya dianthicola ME23)
MSFSQAVSGLNAASNNLDVIGNNIANSATVGFKASNISFADMYAGSNVGLGTRVASVLQD
FSNGSITSTSRSLDVAINGNGFYRLLNTNGSVSYSRNGQFTLDSSRNIVNTQGLQLTGYP
AVGTPPTIQQGADPVGLSIPETTMSAKATGTASIIASLNSSDSANVWDPTDPTNTSNYKG
SITTYDSLGNAHNFALYFVKTAANSWDAYAQDTSVTGAGFQGPTTLSFNTSGALTTTSPA
TLTMATLNGSAASNFTLSFTGTVQQNSGSNSTKTPTQDGYEPGELTGYSISEDGSVIGSY
SNKKTQLLGQIALASFANPEGLSPQGDNVWAATDSSGQAVVNLAGTGNLGKLVGKATESS
NVDMSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR