Protein Info for DZA65_RS13945 in Dickeya dianthicola ME23

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 87 (30 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 198 to 223 (26 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 60 to 256 (197 residues), 310.9 bits, see alignment E=1.8e-97 PF00813: FliP" amino acids 61 to 252 (192 residues), 276.2 bits, see alignment E=8.5e-87

Best Hits

Swiss-Prot: 81% identical to FLIP_PECCC: Flagellar biosynthetic protein FliP (fliP) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 97% identity to ddd:Dda3937_02216)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C2J4 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DZA65_RS13945 flagellar type III secretion system pore protein FliP (Dickeya dianthicola ME23)
MSTTLRPTSFSAWLRLLRCPTVAILFLIAPHALAQLPGIISQPLANGGQSWSLPIQTLVF
ITSLSFIPAVLLMMTCFTRIIIVLGLLRNALGTPTAPPNQVLLGLSLFLTFFVMSPVLNR
IYDEAYRPFSEDKISMEVAIEKGSQPLREFMLRQTREADLALFTRLAQIPSLQGPEAVPI
RVLVPAYVTSELKTAFQIGFTIFIPFLLIDLVVASVLMALGMMMVPPATISLPFKLMLFV
LVDGWQLLLGSLAQSFYT