Protein Info for DZA65_RS13870 in Dickeya dianthicola ME23

Annotation: flagellin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00669: Flagellin_N" amino acids 4 to 140 (137 residues), 150.5 bits, see alignment E=3.2e-48 PF00700: Flagellin_C" amino acids 195 to 279 (85 residues), 97.2 bits, see alignment E=5.7e-32

Best Hits

KEGG orthology group: K02406, flagellin (inferred from 99% identity to ddd:Dda3937_03427)

Predicted SEED Role

"Flagellar biosynthesis protein FliC" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0A1 at UniProt or InterPro

Protein Sequence (280 amino acids)

>DZA65_RS13870 flagellin (Dickeya dianthicola ME23)
MAVINTNSMSLLAQTNLNKSQSSLQTAIERLSSGLAINSAKDNAAGSGIVNGMTAQIKGL
TQASKNANDGVSLVQTAEGNLDTINDNLQRIRELAVQAANDTNGTNDRTAIQTEINRRVD
EINRVAASANFNGKALLDGTVNATGFNIQVGSGTTANDAISVGSAALINATSGGLGITTT
NTDVSTAAGSTALVSAIDTALQTINTAKANIGATLNRFQSTIDNLSNTINNLSNARSRIQ
DADYATEVSNMSRAQILQQAGTSVLAQANQVPQTVLKLLQ