Protein Info for DZA65_RS13765 in Dickeya dianthicola ME23

Annotation: PepSY domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 467 to 493 (27 residues), see Phobius details PF03929: PepSY_TM" amino acids 44 to 440 (397 residues), 231.2 bits, see alignment E=1.2e-72

Best Hits

KEGG orthology group: None (inferred from 56% identity to rah:Rahaq_1219)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCT5 at UniProt or InterPro

Protein Sequence (505 amino acids)

>DZA65_RS13765 PepSY domain-containing protein (Dickeya dianthicola ME23)
MSESKTETSFIQSEALTDAPLMSGTYRNSLARSQRAALQALLMRLHFYIGLFVGPFIFIA
ALTGTLYVLTPQIESTLYSHQLVTNTVGTPRLLSQQITAATHALGDKAQHARLTAVRPSP
EAGLTTRVMFSLPNLGPSESFAVFVDPVSLDIRGALTVYGTSGILPFRTRLDYLHRSLLL
GDIGRNYSELAASWLWIAALGGLYIWISTRKNHPRLRCRSAGRQSPARQRQRLRGTHTVT
GLLLLVGLLFFSATGLTWSRWAGDNVALLRAVMGWQTPSVNTHLDTAPASPTSAHTEHDI
MSMPMHSAASQATPQTFDNVQPLDNVQTFDNVVAAAREAGIDAGKIEIRPAAKTQRAWTV
SEIDRAWPTQVDAVAVDPMTFHVIDNVNFADYPLAAKLTRWGIDAHMGVLFGLPNQLLLS
AFGLGLCSLIVWGYRMWWRRRPTHPAAHSPLQTLTTTFLQLNAHRRLLVLIIAGVLAVSL
PVMGVSLIMFLLIDIWRWSRQRQTA