Protein Info for DZA65_RS13725 in Dickeya dianthicola ME23

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 119 to 134 (16 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 180 (172 residues), 94.3 bits, see alignment E=4e-31

Best Hits

Swiss-Prot: 64% identical to C56I_ECOLI: Cytochrome b561 homolog 2 (yceJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03557)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CIN8 at UniProt or InterPro

Protein Sequence (184 amino acids)

>DZA65_RS13725 cytochrome b (Dickeya dianthicola ME23)
MLWRNTSTRYGHISVLLHWITAATVYGMFALGLWMVALGYYDPWYHNAPEIHKGIGILLF
LALLFRVIWRWVSPPPRPLSSYSTLTHISATLVHIFLYLLLFSILISGYLISTAEGQSIS
VFGWFSVPATLSGIQDQADTAGTIHLYLAWAVVILSVLHALAAFKHHFIDRDATLKRILG
RHAG