Protein Info for DZA65_RS13660 in Dickeya dianthicola ME23

Annotation: ACP S-malonyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00128: malonyl CoA-acyl carrier protein transacylase" amino acids 3 to 291 (289 residues), 424.6 bits, see alignment E=1.1e-131 PF00698: Acyl_transf_1" amino acids 7 to 291 (285 residues), 136.1 bits, see alignment E=9.7e-44

Best Hits

Swiss-Prot: 79% identical to FABD_SALTY: Malonyl CoA-acyl carrier protein transacylase (fabD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 97% identity to ddd:Dda3937_04204)

MetaCyc: 79% identical to [acyl-carrier-protein] S-malonyltransferase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-malonyltransferase. [EC: 2.3.1.39]

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZB2 at UniProt or InterPro

Protein Sequence (309 amino acids)

>DZA65_RS13660 ACP S-malonyltransferase (Dickeya dianthicola ME23)
MTTFAMVFPGQGSQSVGMLAELAEKFPLIKETFDEASSVLGYDLWQLSQQGPAEELNKTW
QTQPALLTASVALWRVWRQQGGALPALMSGHSLGEYSALVCAGVLDFKQAVNLVELRGKL
MQEAVPEGTGAMYAIIGLDNDATAAACAEAAQGQVVSPVNFNSPGQVVIAGNKEAVERAG
AACKAAGAKRALPLPVSVPSHCALMEPAARKLADALEVITFNAPDVPVVNNVDVRAESAP
QAIRSALVRQLHNPVRWTECVEYMAAQGVVTLVEVGPGKVLTGLTKRIVDSLTATAINDP
ASLSAALEQ