Protein Info for DZA65_RS13650 in Dickeya dianthicola ME23

Annotation: acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 TIGR00517: acyl carrier protein" amino acids 1 to 77 (77 residues), 123.7 bits, see alignment E=1e-40 PF00550: PP-binding" amino acids 6 to 73 (68 residues), 57.7 bits, see alignment E=5.8e-20

Best Hits

Swiss-Prot: 99% identical to ACP_PECAS: Acyl carrier protein (acpP) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02078, acyl carrier protein (inferred from 99% identity to pct:PC1_2502)

MetaCyc: 90% identical to acyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Acyl carrier protein" in subsystem Fatty Acid Biosynthesis FASII or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or mycolic acid synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFI9 at UniProt or InterPro

Protein Sequence (78 amino acids)

>DZA65_RS13650 acyl carrier protein (Dickeya dianthicola ME23)
MSTIEERVKKIIVEQLGVKPEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA
EKITTVQAAIDFIQANQQ