Protein Info for DZA65_RS13635 in Dickeya dianthicola ME23
Annotation: endolytic transglycosylase MltG
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to MLTG_ECOLI: Endolytic murein transglycosylase (mltG) from Escherichia coli (strain K12)
KEGG orthology group: K07082, UPF0755 protein (inferred from 95% identity to ddd:Dda3937_02248)MetaCyc: 58% identical to endolytic murein transglycosylase (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]
Predicted SEED Role
"FIG004453: protein YceG like"
MetaCyc Pathways
- peptidoglycan recycling I (13/14 steps found)
- peptidoglycan recycling II (6/10 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.2.f
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385Y3N8 at UniProt or InterPro
Protein Sequence (343 amino acids)
>DZA65_RS13635 endolytic transglycosylase MltG (Dickeya dianthicola ME23) MKRIKRGLGIIVLLALGAWWGWKQIQHLADSPLAIKQETIFTLPAGTNREALKALLVEQQ IIGASGWFPWLLHLEPELAVFKAGTYRLTPNMTVRDMLALLASGKEAQFSLRFVEGSRLK DWQETLKSAPYLRHTLDDKTPQEIAEAMGLKDKLNPEGWFYPDTYLHTAGMSDKSILQRA HQRMTKVLNDVWQGRDEGLPYKTPDDLLVMASLIEKETAINEERPLVASVFINRLRIGMR LQTDPTVIYGMGDSYNGTITRSALEAPTPYNTYVISGLPPTPIAMPGKASLDAAAHPAKT GYLYFVADGKGGHKFTTNLNDHNRAVQAYRSAQAAAGKEKNEQ