Protein Info for DZA65_RS13625 in Dickeya dianthicola ME23

Annotation: DNA polymerase III subunit delta'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF13177: DNA_pol3_delta2" amino acids 11 to 165 (155 residues), 127.8 bits, see alignment E=5.9e-41 TIGR00678: DNA polymerase III, delta' subunit" amino acids 12 to 201 (190 residues), 194.6 bits, see alignment E=6.2e-62 PF21500: HolB_lid" amino acids 167 to 206 (40 residues), 40.4 bits, see alignment 3.1e-14 PF09115: DNApol3-delta_C" amino acids 208 to 321 (114 residues), 138.1 bits, see alignment E=2.7e-44

Best Hits

Swiss-Prot: 57% identical to HOLB_ECOLI: DNA polymerase III subunit delta' (holB) from Escherichia coli (strain K12)

KEGG orthology group: K02341, DNA polymerase III subunit delta' [EC: 2.7.7.7] (inferred from 94% identity to ddd:Dda3937_02250)

MetaCyc: 57% identical to DNA polymerase III subunit delta' (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III delta prime subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYZ3 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DZA65_RS13625 DNA polymerase III subunit delta' (Dickeya dianthicola ME23)
MEWYPWLNAPYRQLLASHQAERGHHALLLHAIDGMGDASLVYAFSRWLLCQQPDGAKSCG
RCHSCGLMSAGTHPDWHTLSPEKGKHSLGVDAVRGVLEPVYQRSRQGGAKVVWLPQAESL
TEAAANALLKTLEEPPAQTYFLLGCREPGRLLATMRSRCLHLHLDVPAEPQGMQWLRGRG
HYDDLALQTALRLAAGAPLAAEALLQPDNWKARQAVCQQLGQSLQSGDALALLPVLNHDD
ADRRLHWVSTLFLDALKWRYQAADQRTNQDQAALVAQLASQPGDARLHHGLRRWLHCRHQ
LRSVTGVNRELLLTELLLAWESLLSSATLPVSSSFS