Protein Info for DZA65_RS13595 in Dickeya dianthicola ME23

Annotation: penicillin-binding protein activator LpoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02722: uncharacterized lipoprotein" amino acids 2 to 196 (195 residues), 159.5 bits, see alignment E=4.9e-51 PF13036: LpoB" amino acids 57 to 193 (137 residues), 119.5 bits, see alignment E=5.7e-39

Best Hits

Swiss-Prot: 96% identical to LPOB_DICD3: Penicillin-binding protein activator LpoB (lpoB) from Dickeya dadantii (strain 3937)

KEGG orthology group: K07337, hypothetical protein (inferred from 96% identity to ddd:Dda3937_02256)

MetaCyc: 48% identical to outer membrane lipoprotein - activator of MrcB activity (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Lipoprotein YcfM, part of a salvage pathway of unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHK7 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DZA65_RS13595 penicillin-binding protein activator LpoB (Dickeya dianthicola ME23)
MKKYLGIVLMALVIAGCSSRAPQTEQPATIEPAVPSTPAKPALPPSESQPLPTPPKIQVP
VLDWSSAVTPLVGQMVKTDGIAKGSILLLNKLKNNTNGSLQTAQATTALYNALASSGQFT
MVSREQLGVARQSLGLSEEDSLESRSKAVGLARYVGAQYVLYADASGDVKSPELSMQLML
VQTGEIAWSGNGTVRQQ