Protein Info for DZA65_RS13495 in Dickeya dianthicola ME23

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF00255: GSHPx" amino acids 6 to 111 (106 residues), 132 bits, see alignment E=3.4e-43

Best Hits

Swiss-Prot: 57% identical to BTUE_ECOLI: Thioredoxin/glutathione peroxidase BtuE (btuE) from Escherichia coli (strain K12)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 95% identity to ddd:Dda3937_03647)

MetaCyc: 57% identical to thioredoxin/glutathione peroxidase BtuE (Escherichia coli K-12 substr. MG1655)
Glutathione peroxidase. [EC: 1.11.1.9]; RXN0-267 [EC: 1.11.1.9, 1.11.1.24]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.24 or 1.11.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZ89 at UniProt or InterPro

Protein Sequence (183 amino acids)

>DZA65_RS13495 glutathione peroxidase (Dickeya dianthicola ME23)
MSNNLYAIPLQTIDGRQASLENWRNNVLLVVNVASQCGLTRQYEALENLYETYRDRGFAV
LGFPSNEFAGQEPGSNEEINAFCRGTFGVQFPMFGKIDVNGSARHPLYQALIQAQPEALR
PQGSEFYERRVSKGQAPAHPGDILWNFEKFLINRRGEAIARFSPDMAPDDGVIIKAIEQA
LAQ