Protein Info for DZA65_RS13385 in Dickeya dianthicola ME23

Annotation: cell division protein ZapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF21083: ZapC_N" amino acids 3 to 89 (87 residues), 115.7 bits, see alignment E=9.3e-38 PF07126: ZapC_C" amino acids 90 to 170 (81 residues), 97.3 bits, see alignment E=4.7e-32

Best Hits

Swiss-Prot: 70% identical to ZAPC_DICP7: Cell division protein ZapC (zapC) from Dickeya paradisiaca (strain Ech703)

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03515)

Predicted SEED Role

"FIG01199806: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYR1 at UniProt or InterPro

Protein Sequence (184 amino acids)

>DZA65_RS13385 cell division protein ZapC (Dickeya dianthicola ME23)
MKLIPDDSWRWYFDTEQARLMLDLANGVVFRSRFSSSMLTPDAFMTSVFCVEDAALFFTY
QEKCQALALPAEARAELVLNALVANRFLKPMMPKSWHFAAQGAAHSSLQTGDQVNVQLNE
RPEAANFMVVEAGDKASLCVLAQGQLALSGKTMQLGDAIKIMHDRLRTVADKGDETSPHY
AFAG