Protein Info for DZA65_RS13380 in Dickeya dianthicola ME23

Annotation: MOSC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF03476: MOSC_N" amino acids 2 to 117 (116 residues), 110.7 bits, see alignment E=5.9e-36 PF03473: MOSC" amino acids 140 to 261 (122 residues), 74.1 bits, see alignment E=1.5e-24 PF00111: Fer2" amino acids 295 to 360 (66 residues), 48.1 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 65% identical to YCBX_ECOLI: Uncharacterized protein YcbX (ycbX) from Escherichia coli (strain K12)

KEGG orthology group: K07140, (no description) (inferred from 94% identity to ddd:Dda3937_03516)

MetaCyc: 65% identical to 6-N-hydroxylaminopurine resistance protein (Escherichia coli K-12 substr. MG1655)
RXN0-7398

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYI8 at UniProt or InterPro

Protein Sequence (367 amino acids)

>DZA65_RS13380 MOSC domain-containing protein (Dickeya dianthicola ME23)
MIVLSRLFVHPVKSMRGIQLSQAMTSASGLAFDRLFMITEPDGTFITARQFPQLVLFTPA
LTHDGVFLSAPDGRTCLVRVDDFAPATAPTEVWGNHFQARIAPEAVNRWLSDYLQRPVQL
RWQGPELSRRVKRHPDIPLGFADGYPFLLINDASFDDLRRRCRAGILIEQFRPNLTVSGA
EAYAEDSWQTLRVGEVVFDVAKPCSRCVLTTVSIERGRKHPSGEPLATLQQYRTAENGDV
DFGINLIARNSGIIRAGDRVEILAAKPPRPYGAGAVTESVTPQASAVKAVQIAYQGQRFT
GNNQQILLEQLEQQGIRVPYSCRAGLCGCCRLTLTDGEVSPLKAGARGEDRTILACSCIP
AGDIQLA