Protein Info for DZA65_RS13360 in Dickeya dianthicola ME23

Annotation: intermembrane transport protein PqiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details PF02470: MlaD" amino acids 36 to 127 (92 residues), 49.7 bits, see alignment E=1.7e-17 amino acids 151 to 227 (77 residues), 38.8 bits, see alignment E=4.5e-14 amino acids 280 to 382 (103 residues), 34.8 bits, see alignment E=7.9e-13

Best Hits

Swiss-Prot: 67% identical to PQIB_ECOLI: Intermembrane transport protein PqiB (pqiB) from Escherichia coli (strain K12)

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 96% identity to ddd:Dda3937_03520)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYJ0 at UniProt or InterPro

Protein Sequence (541 amino acids)

>DZA65_RS13360 intermembrane transport protein PqiB (Dickeya dianthicola ME23)
MAQIDSIKRWSPVWIVPIVTVLIGAWILFYHVSHQGPEITLTTSNAEGIDAGKTTIKSRS
VNVGVVESVMLSEDLHQVEIKARLNDGMDKLLSKDSAFWVVKPQIGREGVSGLGTLLSGS
FIELQPGSGKEDSRAFKLLDSPPLASPDAQGIRIVLNSDQSGQLTAGDPVLFRGYRVGSV
ETSHFDPTARKMQYQLFVAAPYDQLVTANVRFWKDSGVALNLSAQGMRVEMGSLSTLLSG
GVSFDVPVGWEVGGQAHERDEFQLFDNQNSIQDSLYTEYKEYLLFFDESVRGLQAGAPVE
FRGIRLGTVAEVPFFPRNLPQSFGSDYRIPVLVRIEPGRLKRGLRDQINLEQQLSKGAVS
GLRASMKTANLLTGALYVDLDFYPQQKDQVTSLGSMEGYPVLPTVNGGLTQIQQKLMSVL
DKINSLPLNPMVEQATKTLAESQSTLRELQKTLTSLNTFTNSEAMQQLPEDMQRTLRELN
HSLQGVQPGSPAYNRMVGDMQRLDQTLRELQPLLRTLNDKSNALIFEAPGARDPQPKKAK
P