Protein Info for DZA65_RS13355 in Dickeya dianthicola ME23

Annotation: membrane integrity-associated transporter subunit PqiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF03886: ABC_trans_aux" amino acids 24 to 179 (156 residues), 134.4 bits, see alignment E=1.5e-43

Best Hits

Swiss-Prot: 48% identical to PQIC_ECOLI: Intermembrane transport lipoprotein PqiC (pqiC) from Escherichia coli (strain K12)

KEGG orthology group: K09857, hypothetical protein (inferred from 94% identity to ddd:Dda3937_03521)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCA7 at UniProt or InterPro

Protein Sequence (187 amino acids)

>DZA65_RS13355 membrane integrity-associated transporter subunit PqiC (Dickeya dianthicola ME23)
MMKRWPLWLVLLLGACSSPQRVYYQLPAATQSTSVSVASTEGRQLWVAPVTLADSLAGNG
IVFQTSAVRYTIAANNLWASPLDQQLQQALAASLRNGLPGWHVAATGAASDNASSLQVNV
TAFQGRFDGKAVIRGEWILQGSKRVVTQPFNIEVPQADDGYDALVGALGKGWQQVAEQVR
QRLQAGA