Protein Info for DZA65_RS13280 in Dickeya dianthicola ME23

Annotation: L,D-transpeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03734: YkuD" amino acids 99 to 234 (136 residues), 83.3 bits, see alignment E=2.6e-27 PF17969: Ldt_C" amino acids 238 to 304 (67 residues), 93.5 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 60% identical to YCFS_ECOLI: Probable L,D-transpeptidase YcfS (ycfS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_03663)

MetaCyc: 60% identical to L,D-transpeptidase LdtC (Escherichia coli K-12 substr. MG1655)
RXN0-5401

Predicted SEED Role

"L,D-transpeptidase YcfS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYN8 at UniProt or InterPro

Protein Sequence (329 amino acids)

>DZA65_RS13280 L,D-transpeptidase family protein (Dickeya dianthicola ME23)
MKRTLTLVGLLFTSCLAGIQPASATEYPLPPPDSRLIGENISYTVPNDGHPLEVIAAKFK
IGLLGMLEANPGTDPYLPKPGSSLTIPLQMLLPDTPREGVVVNLAELRLYYFPKGKNTVI
VYPIGIGQLGRNTPVMVTRVIERRPNPTWIPTANIRRHYKEQGVTLPAVVPGGPDNPMGL
FALRLEKSGGVYSIHGTNADFGIGMRVSSGCIRLRPEDIEALFNDVPVGTRVQIINEPVK
IALEPDGKRYVEAHQPLSRTDKDDPQTMPIALSQKVKAFIKHDDTDAEAAQNAIVRRSGM
PVLVNTGQNIPSLQQQGAPISAVVTSPSH