Protein Info for DZA65_RS13150 in Dickeya dianthicola ME23

Annotation: riboflavin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00187: riboflavin synthase, alpha subunit" amino acids 1 to 204 (204 residues), 271.9 bits, see alignment E=1.2e-85 PF00677: Lum_binding" amino acids 3 to 87 (85 residues), 79.4 bits, see alignment E=8.5e-27 amino acids 100 to 185 (86 residues), 84.2 bits, see alignment E=2.7e-28

Best Hits

Swiss-Prot: 80% identical to RISA_ECOLI: Riboflavin synthase (ribC) from Escherichia coli (strain K12)

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 95% identity to ddd:Dda3937_04105)

MetaCyc: 80% identical to riboflavin synthase (Escherichia coli K-12 substr. MG1655)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYL4 at UniProt or InterPro

Protein Sequence (217 amino acids)

>DZA65_RS13150 riboflavin synthase (Dickeya dianthicola ME23)
MFTGIVQGTATVVSIDEKPNFRTHVVQLPAELLPGLETGASVAHNGCCLTVTQIDGDRVS
FDLIKETLRLTNLGDVNVGGRVNVERAAKYGDEIGGHVMSGHIMCTAEVVKILTSENNHQ
IWFRLSDESQMKYVLHKGFIGIDGISLTVGEVTRSRFCVHLIPETLQRTTLGQKRLGDRI
NIEIDPQTQAIIDTVERVLARQTPQHEQVAVPVEPGE