Protein Info for DZA65_RS13100 in Dickeya dianthicola ME23

Annotation: glycine zipper 2TM domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05433: Rick_17kDa_Anti" amino acids 62 to 103 (42 residues), 36 bits, see alignment E=2.6e-13

Best Hits

Swiss-Prot: 71% identical to SLYB_ECO57: Outer membrane lipoprotein SlyB (slyB) from Escherichia coli O157:H7

KEGG orthology group: K06077, outer membrane lipoprotein SlyB (inferred from 96% identity to dze:Dd1591_1723)

Predicted SEED Role

"Outer membrane lipoprotein pcp precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYP0 at UniProt or InterPro

Protein Sequence (155 amino acids)

>DZA65_RS13100 glycine zipper 2TM domain-containing protein (Dickeya dianthicola ME23)
MMKRFLVITLAGITLAGCANTSTLSGDVYSASEAKQVQTVAYGTVVSTRPVQIQAGEDSN
VIGTLGGAVLGGLVGNTVGRGTGRNLATAAGAVAGGVAGNSIEGAVNRVQGVELEIRKDD
GSTIMVVQKQGDTKFHAGQRVAMANNGRSITVSPR