Protein Info for DZA65_RS13095 in Dickeya dianthicola ME23

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF03702: AnmK" amino acids 5 to 367 (363 residues), 556.2 bits, see alignment E=1.8e-171

Best Hits

Swiss-Prot: 80% identical to ANMK_PECCP: Anhydro-N-acetylmuramic acid kinase (anmK) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 97% identity to ddd:Dda3937_00062)

MetaCyc: 72% identical to anhydro-N-acetylmuramic acid kinase (Escherichia coli K-12 substr. MG1655)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQS0 at UniProt or InterPro

Protein Sequence (370 amino acids)

>DZA65_RS13095 anhydro-N-acetylmuramic acid kinase (Dickeya dianthicola ME23)
MRSGRYIGVMSGTSLDGVDVVLAAIDEHTVAQQASYCHPLSPAIRQTILGMNQGQAVTLS
ELGRLDTRLGALFADAVHALLRQTGLSASEITAIGCHGQTVWHEPGGDAPCTLQIGDCNR
IAAVTGITTVGDFRRRDMALGGQGAPLVPVFHHALLQHPVERRIVLNIGGIANISVLVPG
RPVKGYDTGPGNMLLDAWVWRHRAQPYDKDAAWALTGQVDNALLSHMLSDPYFGLPAPKS
TGREYFNLAWLERQLAAFPRLRPEDVQATLAALSAETIAGQVLLTGGCERVLVCGGGARN
PLLMSQLSARLPGIEVSATDNFGIRGDDMEALAFAWLAFRTLSGLPGNLPSVTGASRETV
LGAIYPAMTV