Protein Info for DZA65_RS13085 in Dickeya dianthicola ME23

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 84% identical to PDXH_PECAS: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 93% identity to dze:Dd1591_1726)

MetaCyc: 80% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
pyridoxal 5'-phosphate salvage I (5/6 steps found)
pyridoxal 5'-phosphate salvage II (plants) (7/9 steps found)
4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1Y5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>DZA65_RS13085 pyridoxamine 5'-phosphate oxidase (Dickeya dianthicola ME23)
MAPGENAAAVDIADLRREYTRGGLRRHDLTDNPLDLFERWLKQACEAQLADPTAMCVATV
DEQGQPYQRIVLLKHYDEKGMVFYTNMGSRKAQQLAVNSRISLLFPWHMLERQVIVLGKA
EKLPMLDVMKYFHSRPRDSQIGAWVSKQSSRISARGMLESKFFEMKQKFQQGEIPLPSFW
GGFRVTIASMEFWQGGEHRLHDRFLYQRESDGWAIDRLAP