Protein Info for DZA65_RS13035 in Dickeya dianthicola ME23

Annotation: lipopolysaccharide assembly protein LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF13176: TPR_7" amino acids 73 to 94 (22 residues), 15.7 bits, see alignment (E = 7.9e-06) amino acids 219 to 244 (26 residues), 19.9 bits, see alignment (E = 3.6e-07) PF13432: TPR_16" amino acids 190 to 244 (55 residues), 21.5 bits, see alignment 1.6e-07 PF14559: TPR_19" amino acids 191 to 245 (55 residues), 41.7 bits, see alignment 7.4e-14 PF13181: TPR_8" amino acids 215 to 244 (30 residues), 18.3 bits, see alignment (E = 1.2e-06) PF13174: TPR_6" amino acids 219 to 243 (25 residues), 17.5 bits, see alignment (E = 3.2e-06) PF18073: Zn_ribbon_LapB" amino acids 355 to 382 (28 residues), 44 bits, see alignment (E = 8.4e-15)

Best Hits

Swiss-Prot: 72% identical to LAPB_ECO57: Lipopolysaccharide assembly protein B (lapB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to ddc:Dd586_1686)

Predicted SEED Role

"Heat shock (predicted periplasmic) protein YciM, precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCX4 at UniProt or InterPro

Protein Sequence (389 amino acids)

>DZA65_RS13035 lipopolysaccharide assembly protein LapB (Dickeya dianthicola ME23)
MLELLFLLLPVAAAYGWYMGRRSVQQDKQDETNRLSREYVTGVNFLLSNQQDKAVELFLD
MLKDDSNTFEAHLTLGNLFRSRGEVDRAIRIHQALTESASLSFEQRLLAVQQLGRDYMVA
GLYDRAEEIFKQLVDEEEFRVSALQQLLQIHQSTSDWPNAIDTAEKLVKLGKTQLRSEIA
HFYCEQSLQAMGSDDLDKAMAMLKKASAADTQCARVSIMLGRIYMAQQNYAQAVAVLQQV
LEQDTELVSETLPMLQECYRHLQQPESWAAFLRRCVEEKSGSTTDLMMADVLEQYESTES
AQTYITRQLQRHPTMRMFHRLIDYHLREAEDGRAKESLLVLRNMVGEQIQAKPRYRCHKC
GFTSQSLYWHCPSCRTWASVKPIRGLDGE