Protein Info for DZA65_RS13015 in Dickeya dianthicola ME23

Annotation: L-ribulose-5-phosphate 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 75% identical to ARAD_SALTY: L-ribulose-5-phosphate 4-epimerase (araD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01786, L-ribulose-5-phosphate 4-epimerase [EC: 5.1.3.4] (inferred from 98% identity to ddd:Dda3937_03100)

MetaCyc: 76% identical to L-ribulose-5-phosphate 4-epimerase SgbE (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 4-epimerase. [EC: 5.1.3.4]

Predicted SEED Role

"L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4)" in subsystem L-Arabinose utilization or L-ascorbate utilization (and related gene clusters) (EC 5.1.3.4)

MetaCyc Pathways

L-arabinose degradation I (4/4 steps found)
L-lyxose degradation (2/4 steps found)
L-ascorbate degradation II (bacterial, aerobic) (3/7 steps found)
L-ascorbate degradation I (bacterial, anaerobic) (1/5 steps found)
superpathway of pentose and pentitol degradation (12/42 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0M0 at UniProt or InterPro

Protein Sequence (231 amino acids)

>DZA65_RS13015 L-ribulose-5-phosphate 4-epimerase (Dickeya dianthicola ME23)
MLEELKIQVFEANLALPRHQLVTFTWGNVSAVDRERGLMVIKPSGVEYDVMTAQDMVVVE
LESGRVVEGQRKPSSDTDTHRALYLAFASLGGIVHTHSRHATIWAQAGKDLPPWGTTHAD
YFYGPIPCTRLMTEAEINGRYEWETGQVIVDTFRERGLSPQDIPAVLVNAHGPFAWGTDA
HNAVHNAVVLEEIAYMGIFSRQLTPALEPMQAALLDKHYLRKHGKNAYYGQ