Protein Info for DZA65_RS12955 in Dickeya dianthicola ME23

Annotation: peptide ABC transporter substrate-binding protein SapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00496: SBP_bac_5" amino acids 81 to 458 (378 residues), 291.9 bits, see alignment E=4e-91

Best Hits

Swiss-Prot: 74% identical to SAPA_SALTY: Peptide transport periplasmic protein SapA (sapA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 97% identity to ddd:Dda3937_03113)

Predicted SEED Role

"Peptide transport periplasmic protein sapA (TC 3.A.1.5.5)" in subsystem ABC transporter peptide (TC 3.A.1.5.5) (TC 3.A.1.5.5)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZ11 at UniProt or InterPro

Protein Sequence (570 amino acids)

>DZA65_RS12955 peptide ABC transporter substrate-binding protein SapA (Dickeya dianthicola ME23)
MSGKHTLALALAWLALPVLAQTPPTAPTPAQAIRHSGFVYCVNDVLSTFNPQMARSGLMV
DTLAAQLYDRLLGVDPYTYRLMPELAQHWDVTDNGSTYRFTLRRDVPFQRTAWFTPSRTM
NADDVLFSFQRMLNKKHPFHDVNGGDYPYFDSLQLADNVQSIRKLGDYSIEIRLHSPDAS
FLWHLATHYAPVLSAEYAQQLTRQDRRELLDRQPVGTGPYRLDEYRYGQYVRLKRHDDYW
RGQPRMEQVLVDLGSGGTGRLSKLLTGECDVLAYPAASQLTILRNDPRLRLSLRPGMNVA
YLAFNVRKPPLDDSRVRHAIALAINNDRLMQSIYYGTAETAASILPRASWAYDNEAQVTE
YNPEKARQQLKELGITNLQLQLWVPSASQSYNPSPVKTAELIQADLAQVGIRVTIMPVEG
RFQEARLMEMNHDLTLAGWATDSNDPDSVFRPLLSCAAIRSQTNYAHWCDPGFDQVLQDA
LSSQQLSRRMEYYRVAHHILAEQLPVLPLASSLRMQAYRYDMKGLVLSPFGNASFAGVYR
DDGSEEKNQEKPDDSAVDPSSSEPIQGEQP